PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.20G160200.1.p
Common NameGLYMA_20G160200, LOC100785821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 992aa    MW: 109646 Da    PI: 5.8277
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.20G160200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.51.3e-28584634252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Glyma.20G160200.1.p 584 EKSISLEVLQRYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 634
                          799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.473573654IPR003035RWP-RK domain
PfamPF020421.8E-25587634IPR003035RWP-RK domain
SuperFamilySSF542772.0E-23892981No hitNo description
SMARTSM006668.1E-27896978IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.7E-27896977No hitNo description
PfamPF005643.1E-19896977IPR000270PB1 domain
PROSITE profilePS5174524.865896978IPR000270PB1 domain
CDDcd064073.64E-37897977No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 992 aa     Download sequence    Send to blast
MPESEEENQD YVPRSKPSEE AGGGCTMDFD LDLETSWPLD HMAFGSNPMS PFLFSTSSDQ  60
PYSPLWAFSD GEDPKLPASA FSDCHKIFSC DSNSIAEKPV ENDDNKKLLP PLVPISPVEN  120
LDGYCVIKER MTQALRYFKE LTELNVLAQV WAPVKNGNRY VLTTSGQPFV LDPHSNGLYQ  180
YRTVSLMYMF SVDGENDGSL GLPGRVFQQK LPEWTPNVLY YSSKEYPRRD HAQHYNVRGT  240
LALPVFEPSI QSCVGVLELI MTSQKINYAP EVDKICKALE TVNLRSSEIL DHPHTQICNE  300
GRQNALSEIL EILTVVCETH NLPLAQTWIP CKHRSVLAQG GGVKKSCSSF DGRCMGKVCM  360
STTDIAFYII DAHLWGFREA CVEHHLQQGQ GVAGRAFLSH GMCFCSNITQ FYKTDYPLVH  420
YALMFGLTSC FAICLRSSHT GNDDYVLEFF LPPRITHIHE QKTLLGSILA IMKQHFQSLH  480
IASGVEPEDG SIEIIEATIE RVHTRLESIP IASSIKSPPR PDTSPNMGEE VPQDPSEQQI  540
LMYCNDINNG GSLGENAARN IDHMPSLETK NINKPLERKR GKTEKSISLE VLQRYFAGSL  600
KDAAKSLGVC PTTMKRICRQ HGISRWPSRK INKVNRSLSK LKRVIESVQG AEGAFGLNSL  660
SKSPLPIAVG SFPEPSTPNK FSLPASLSIN PSEPQIKENE LNASKALETN SQAVMEEDRL  720
LGGRTPHLEK VINDKGRHTR EVGKEPKRTR TGSGSSEDST NPTSHGSCHD SPPNESSPVK  780
NIFITSNNDQ CAGLKRSPES TLQLTTNTPN RPAAYPMPDF VAAELQEPFG GMLIEDAGSS  840
KDLRNLCPSV AETILEDMVP EACGTNIPGP DLSPKQSMGT PNKAVTPFVA MKEMKTVTIK  900
ATYREDIIRF RVSLTCGIVE LKEEVAKRLK LEVGTFEIKY LDDDHEWVLI ACDADLQECM  960
DVSRSSGSKI IRVLVHDITS NLGSSCESSG E*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006606125.10.0PREDICTED: protein NLP6-like isoform X1
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLK7N3R80.0K7N3R8_SOYBN; Uncharacterized protein
STRINGGLYMA20G29960.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7